PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR02G10380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family M-type_MADS
Protein Properties Length: 192aa    MW: 21763.4 Da    PI: 10.1232
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR02G10380.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF46.26e-151050242
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                     ri n+  r  tf kR++g+ KKA+EL +LC+++ + +++++
  LPERR02G10380.1 10 RILNDAHRRATFKKRLKGLTKKASELATLCGVDMCFMVYGE 50
                     899************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554559.42E-21185IPR002100Transcription factor, MADS-box
SMARTSM004325.3E-13161IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.932150IPR002100Transcription factor, MADS-box
CDDcd002664.18E-21286No hitNo description
PRINTSPR004042.9E-8323IPR002100Transcription factor, MADS-box
PfamPF003195.9E-161050IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-82338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MARKRVKLQR ILNDAHRRAT FKKRLKGLTK KASELATLCG VDMCFMVYGE GAVEVTEVWP  60
SVPEATSVLE RFKAMPDLER YKKTTNLEGF LKESINKLQK ELHKVKSEAD KSETKLLLVE  120
ALDGRHLTFE RLTVEQLTSL ARMVDARLKI VNNRLEELRG QGLLLAPTPL LAKGPLPHDT  180
VDYTNVEKPP SQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1225RKRVKLQRILNDAHRRATFKKRLK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629573.12e-78PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A0D9VEU61e-139A0A0D9VEU6_9ORYZ; Uncharacterized protein
STRINGORGLA03G0226500.11e-78(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36336202
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.22e-23M-type_MADS family protein